Illustrations
Herb And Spice Seamless Pattern
Price:
$2.00
Digital product. No physical item will be shipped.
License:
Standard License: for one commercial project or up to 500 physical end products for sale.
Extended License: for broader commercial use, multiple projects, and larger product runs.
File type: EPS
Editable vector file.
Editable vector file.
By purchasing, you receive a license to use this file. Copyright ownership is not transferred.
About the product
A seamless herb and spice pattern featuring parsley, thyme, cumin, laurel, mint, sage, and cilantro in a Middle Eastern-inspired food motif. The artwork uses a hand-drawn sketch style with clean linework and a vintage botanical feel, giving it a natural, artisanal look. Use it for packaging, menus, recipe cards, labels, textile prints, or as a textured background for culinary branding and editorial design. The design is supplied as an .eps vector file, making it easy to scale and edit in your preferred vector software.
- 1 hand-drawn illustration
- editable EPS vector file
- scalable artwork for print and digital design
Delivered as an editable EPS vector file for easy scaling, recolouring, and layout adaptation within permitted licensed use.
Related keywords
asiaasianbadgebay leafblackbotanicalbowlcilantrocookingcoriandercuisinecumindesigndilldrawingdrinkengravedfoodhand-drawnherbalherbsillustrationingredientkitchenlabellaurelleafleavesline artmiddle easternmintparsleyrecipesageseedsketchspicespicyspoonthymevectorvintageseamlesspatternbackgroundbackdroptexturepackaging
