Illustrations
Herb And Spice Seamless Pattern
Price:
$2.00
License:
For 1 commercial project or up to 500 units for sale.
Read full license termsFile type: EPS
About the product
A seamless herb and spice pattern featuring parsley, thyme, cumin, laurel, mint, sage, and cilantro in a Middle Eastern-inspired food motif. The artwork uses a hand-drawn sketch style with clean linework and a vintage botanical feel, giving it a natural, artisanal look. Use it for packaging, menus, recipe cards, labels, textile prints, or as a textured background for culinary branding and editorial design. The design is supplied as an .eps vector file, making it easy to scale and edit in your preferred vector software.
Delivered as a fully scalable .eps vector file.
Related keywords
asiaasianbadgebay leafblackbotanicalbowlcilantrocookingcoriandercuisinecumindesigndilldrawingdrinkengravedfoodhand-drawnherbalherbsillustrationingredientkitchenlabellaurelleafleavesline artmiddle easternmintparsleyrecipesageseedsketchspicespicyspoonthymevectorvintageseamlesspatternbackgroundbackdroptexturepackaging










