Illustrations
Spring Garden Seamless Pattern
Price:
$2.00
Digital product. No physical item will be shipped.
License:
Standard License: for one commercial project or up to 500 physical end products for sale.
Extended License: for broader commercial use, multiple projects, and larger product runs.
File type: EPS
Editable vector file.
Editable vector file.
By purchasing, you receive a license to use this file. Copyright ownership is not transferred.
About the product
A vintage seamless spring garden pattern filled with birds, flowers, leaves, and blooming tree branches. The artwork uses hand-drawn botanical sketches with an engraved feel, combining almond, willow, rowan, and cherry blossom details in a classic decorative style. Use it for textile prints, stationery, wrapping paper, wallpaper, packaging, or seasonal branding that needs a refined natural motif. The design is delivered as an editable .eps vector file for easy scaling and customization in your preferred vector editor.
- 1 hand-drawn illustration
- editable EPS vector file
- scalable artwork for print and digital design
Delivered as an editable EPS vector file for easy scaling, recolouring, and layout adaptation within permitted licensed use.
Related keywords
almondanimalbackgroundbeautifulbirdbirdsbloombloomingblossombotanicalbranchcherrycherry blossomcurrantdecordecorativedesigndrawingdrawnengravingfloralflowerflyingframegardengraphicgreat tithand drawnillustrationinvitationisolatedleafnaturenuthatchplantprintrowansakurasketchsketchedsparrowspringtreevectorvintagewildlifewillowseamlesspatterntexture
