
About the product
A vintage seamless spring garden pattern filled with birds, flowers, leaves, and blooming tree branches. The artwork uses hand-drawn botanical sketches with an engraved feel, combining almond, willow, rowan, and cherry blossom details in a classic decorative style. Use it for textile prints, stationery, wrapping paper, wallpaper, packaging, or seasonal branding that needs a refined natural motif. The design is delivered as an editable .eps vector file for easy scaling and customization in your preferred vector editor.
Additional information
Get the illustration above as a fully scalable .eps vector file.
Related keywords
almondanimalbackgroundbeautifulbirdbirdsbloombloomingblossombotanicalbranchcherrycherry blossomcurrantdecordecorativedesigndrawingdrawnengravingfloralflowerflyingframegardengraphicgreat tithand drawnillustrationinvitationisolatedleafnaturenuthatchplantprintrowansakurasketchsketchedsparrowspringtreevectorvintagewildlifewillowseamlesspatterntexture
Spring Garden Seamless Pattern
Price:
$2.00
License:



