Illustrations
Yellow Warbler Spring Seamless Pattern
Price:
$2.00
License:
For 1 commercial project or up to 500 units for sale.
Read full license termsFile type: EPS
About the product
A yellow warbler perched on a blooming Japanese quince branch creates a lively spring scene with vintage character. The artwork is rendered in an engraved-inspired hand-drawn style with colored sketch details, giving it a refined botanical feel and a classic wildlife illustration look. Use it for seamless textile patterns, stationery, wrapping paper, fabric prints, or seasonal branding that needs a fresh nature motif. The design is supplied as an editable .eps vector file, making it easy to scale and adapt for professional print projects.
Delivered as a fully scalable .eps vector file.
Related keywords
animalbackgroundbeautifulbirdbirdsdesigndrawingdrawnengravedflygardengraphichand drawnillustrationisolatednaturepasserineperchingprintsketchsketchedsongbirdvectorvintagewarblerwildwildlifewingyellowyellow warblerbloomingsittingJapanese quincequincebranchtreebloomblossomflowerfloweringspringstyleisolatedseamlesspatternbackgroundprinttextilecolorcolorful










