Yellow Warbler Spring Seamless Pattern

About the product
A yellow warbler perched on a blooming Japanese quince branch creates a lively spring scene with vintage character. The artwork is rendered in an engraved-inspired hand-drawn style with colored sketch details, giving it a refined botanical feel and a classic wildlife illustration look. Use it for seamless textile patterns, stationery, wrapping paper, fabric prints, or seasonal branding that needs a fresh nature motif. The design is supplied as an editable .eps vector file, making it easy to scale and adapt for professional print projects.
Additional information
Get the illustration above as a fully scalable .eps vector file.
Related keywords
animalbackgroundbeautifulbirdbirdsdesigndrawingdrawnengravedflygardengraphichand drawnillustrationisolatednaturepasserineperchingprintsketchsketchedsongbirdvectorvintagewarblerwildwildlifewingyellowyellow warblerbloomingsittingJapanese quincequincebranchtreebloomblossomflowerfloweringspringstyleisolatedseamlesspatternbackgroundprinttextilecolorcolorful
Yellow Warbler Spring Seamless Pattern
Price:
$2.00
License:
For 1 commercial project or up to 500 units for sale.
Read full license termsFile type: EPS



