Illustrations
Yellow Warbler Spring Seamless Pattern
Price:
$2.00
Digital product. No physical item will be shipped.
License:
Standard License: for one commercial project or up to 500 physical end products for sale.
Extended License: for broader commercial use, multiple projects, and larger product runs.
File type: EPS
Editable vector file.
Editable vector file.
By purchasing, you receive a license to use this file. Copyright ownership is not transferred.
About the product
A yellow warbler perched on a blooming Japanese quince branch creates a lively spring scene with vintage character. The artwork is rendered in an engraved-inspired hand-drawn style with colored sketch details, giving it a refined botanical feel and a classic wildlife illustration look. Use it for seamless textile patterns, stationery, wrapping paper, fabric prints, or seasonal branding that needs a fresh nature motif. The design is supplied as an editable .eps vector file, making it easy to scale and adapt for professional print projects.
- 1 hand-drawn illustration
- editable EPS vector file
- scalable artwork for print and digital design
Delivered as an editable EPS vector file for easy scaling, recolouring, and layout adaptation within permitted licensed use.
Related keywords
animalbackgroundbeautifulbirdbirdsdesigndrawingdrawnengravedflygardengraphichand drawnillustrationisolatednaturepasserineperchingprintsketchsketchedsongbirdvectorvintagewarblerwildwildlifewingyellowyellow warblerbloomingsittingJapanese quincequincebranchtreebloomblossomflowerfloweringspringstyleisolatedseamlesspatternbackgroundprinttextilecolorcolorful
